Protein Info for CSW01_01485 in Vibrio cholerae E7946 ATCC 55056

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00356: LacI" amino acids 8 to 53 (46 residues), 58.3 bits, see alignment 1e-19 PF00532: Peripla_BP_1" amino acids 65 to 322 (258 residues), 120.8 bits, see alignment E=1.6e-38 PF13407: Peripla_BP_4" amino acids 67 to 313 (247 residues), 85 bits, see alignment E=1.2e-27 PF13377: Peripla_BP_3" amino acids 175 to 332 (158 residues), 101.6 bits, see alignment E=1e-32

Best Hits

Swiss-Prot: 50% identical to GNTR_ECOL6: HTH-type transcriptional regulator GntR (gntR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 99% identity to vcm:VCM66_0274)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>CSW01_01485 transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MTKKQRATLQDVADQVGVTKMTVSRYLRSPDSVAAATREKIALAVEALGYIENRAPAMLS
KSSSKAIGILLPSLSNQIFASFVQGIEAVTKANGYETLLAHFGYDEEEEERKIASLLAYQ
VDGLILTESHHTQRTLQMIASSGVPVVETMELPANPIDMAVGMDHVEASYQAVKKIIAAG
KRSIAYFGARLDTRTKLRMQGYDQAMQEAGLPIKHVLTGSHSSFSLAAQLLDEAFARYPD
LDGVFCTNDDIAIGTLLVAQQRGIRVPEQLSVIGYNALDIGRTITPKLTSVDSPRYAIGE
KSAELLIAALKGERAEQQVVDMGYRFTAGESV