Protein Info for CSW01_01465 in Vibrio cholerae E7946 ATCC 55056

Annotation: ketohydroxyglutarate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase" amino acids 3 to 200 (198 residues), 286.8 bits, see alignment E=3.5e-90 PF01081: Aldolase" amino acids 3 to 195 (193 residues), 250.3 bits, see alignment E=5.4e-79

Best Hits

Swiss-Prot: 54% identical to ALKH_HAEIN: Putative KHG/KDPG aldolase (eda) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to vco:VC0395_A2663)

MetaCyc: 45% identical to 2-dehydro-3-deoxy-D-gluconate-6-phosphate aldolase (Dickeya dadantii 3937)
2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.2.14, 4.1.2.55]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.2.55 or 4.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>CSW01_01465 ketohydroxyglutarate aldolase (Vibrio cholerae E7946 ATCC 55056)
MTIEQRLRAIKIVPVIAINDVAHALPLAKVLVENGLPCAEVTFRTAAAAESIRIMRKAYP
DLLIGAGTVLTTAQVDEAIAAGADFIVSPGLNPTTVKYCQQRNIAIIPGVNNPSLVEQAM
EMGLRTLKFFPAEPSGGIAMLKALSAVYPVSFMPTGGINPNNAQEYLALKSVVACGGTWM
VPTDLMDKGDWDTLAELVRNV