Protein Info for CSW01_01415 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF02844: GARS_N" amino acids 1 to 102 (102 residues), 135.1 bits, see alignment E=3.6e-43 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 423 (423 residues), 618.6 bits, see alignment E=2.7e-190 PF01071: GARS_A" amino acids 103 to 296 (194 residues), 279 bits, see alignment E=5.6e-87 PF02655: ATP-grasp_3" amino acids 104 to 291 (188 residues), 23.9 bits, see alignment E=9.7e-09 PF02786: CPSase_L_D2" amino acids 109 to 205 (97 residues), 24.8 bits, see alignment E=3.5e-09 PF02843: GARS_C" amino acids 332 to 421 (90 residues), 116.2 bits, see alignment E=1.6e-37

Best Hits

Swiss-Prot: 100% identical to PUR2_VIBCH: Phosphoribosylamine--glycine ligase (purD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 100% identity to vcj:VCD_001346)

MetaCyc: 78% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>CSW01_01415 phosphoribosylamine--glycine ligase (Vibrio cholerae E7946 ATCC 55056)
MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA
QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA
AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA
GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT
QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM
MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA
GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY
RAIAREQAK