Protein Info for CSW01_01400 in Vibrio cholerae E7946 ATCC 55056

Annotation: HlyC/CorC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details PF01595: CNNM" amino acids 10 to 177 (168 residues), 92.4 bits, see alignment E=2.9e-30 PF00571: CBS" amino acids 260 to 313 (54 residues), 30.7 bits, see alignment 3.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2649)

Predicted SEED Role

"CBS-domain containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>CSW01_01400 HlyC/CorC family transporter (Vibrio cholerae E7946 ATCC 55056)
MFLLAIYISVAIGVSFICSVLEAVLLSITPSYLAQLRQQGHPAANRLAGLKADIDRPLAS
ILTLNTIAHTIGAATAGAQAAVVFGSQWLGLFSAVLTLGILVLSEIVPKTIGATYWRELA
PQASLVLRWMVWALTPFVWFSEQITKRLARKVEAPKLRDEISAMAMLANENGEFAEGESK
MLNNLLAIQNVPVTQVMTPRPVLFRVSADLTIDEFIEQHRDTPFSRPLIYSEEKDNIVGF
VHRLELFKEQQNGQGNLLLGDVMRPIHVVLNTLSLPKAFDQMMQKRLQLSVVVDEYGSVQ
GLLTLEDIFEHLLGEEIIDEADRTTDMQQLATERWEHWKRQHRMIESRDEVE