Protein Info for CSW01_01390 in Vibrio cholerae E7946 ATCC 55056

Annotation: mannose-6-phosphate isomerase, class I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00218: mannose-6-phosphate isomerase, class I
  • amino acids 9 to 390 (382 residues), 286 bits, E=2.2e-89
• PF20511: PMI_typeI_cat
  • amino acids 11 to 158 (148 residues), 118.9 bits, E=3.1e-38
• PF20512: PMI_typeI_hel
  • amino acids 171 to 246 (76 residues), 42.8 bits, E=9.2e-15
• PF21621: MPI_cupin_dom
  • amino acids 322 to 399 (78 residues), 32.4 bits, E=1.1e-11

Best Hits

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 100% identity to vco:VC0395_A2647)

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

• GDP-mannose biosynthesis (4/4 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• D-mannose degradation I (1/2 steps found)
• D-mannose degradation II (1/2 steps found)
• mannitol degradation II (2/4 steps found)
• mannitol biosynthesis (1/3 steps found)
• 1,5-anhydrofructose degradation (2/5 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Protein Sequence (399 amino acids)

>CSW01_01390 mannose-6-phosphate isomerase, class I (Vibrio cholerae E7946 ATCC 55056)
MNTAIPAPFFIMHNVIQSYAWGSIDSINQLFDIPNPKGEPQAEVWMGTHPNGCSYVEFSG
EKIKLSTLIEQKKTDFLSIQTVEQFGELPYLFKILAANQALSIQVHPSKAEAEEGFAREN
AQGILINATNRNYKDPNHKPELVYALTNYQAMNGFRPLSDIISLFSALAIDEIASLLSHL
KRNQNETGLEHFFTKLLSLCGEKKRRVLEQLLSYARSHAKQPIFALIEELATQYPNDIGL
FAPLMLHVLTLQPGEAMFLDARTPHAYLKGTALEIMANSDNVLRAGLTPKHIDVVELAKC
TLFKEKSEATLLLTPIQQGDMLSFPVPVADFKFAIFPRPQQANITVSSAEILLPIDCDAT
LVSPCGTVLTVHKGQSVFIPAYTEKYCLSAAGRVARAYN