Protein Info for CSW01_01355 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 10 to 190 (181 residues), 73.9 bits, E=4.3e-24
• PF01370: Epimerase
  • amino acids 11 to 233 (223 residues), 119.7 bits, E=5e-38
• PF16363: GDP_Man_Dehyd
  • amino acids 12 to 312 (301 residues), 46 bits, E=1.9e-15
• PF01073: 3Beta_HSD
  • amino acids 12 to 256 (245 residues), 86 bits, E=8.5e-28
• PF13460: NAD_binding_10
  • amino acids 15 to 175 (161 residues), 54.6 bits, E=4.5e-18
• PF02719: Polysacc_synt_2
  • amino acids 42 to 258 (217 residues), 32.1 bits, E=2.5e-11
• PF07993: NAD_binding_4
  • amino acids 57 to 185 (129 residues), 57.5 bits, E=4.1e-19

Best Hits

Swiss-Prot: 52% identical to GALE_VIBCL: UDP-glucose 4-epimerase (galE) from Vibrio cholerae

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_001360)

MetaCyc: 51% identical to UDP-N-acetyl-alpha-D-quinovosamine dehydrogenase (Rhizobium etli)
RXN-14767 [EC: 1.1.1.426]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• stachyose degradation (6/7 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-N-acetyl-α-D-quinovosamine biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (9/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.426 or 5.1.3.2

Protein Sequence (323 amino acids)

>CSW01_01355 UDP-glucose 4-epimerase (Vibrio cholerae E7946 ATCC 55056)
MEPDNQTPLKILVTGASGFVGLRVLTQAQNIGYALVAQSRSQQPYSFEQVLLDITPNTDW
ERALVGVDCVVHCAARVHQMQETEADALKAYRDVNTQGTLNLAKQAVSAGVKRFIFLSSI
KVNGEQTKAGSAFQHDDQHIPSDPYGLSKYEAEQQLLELAAETGLEVVIIRPPLVYGEGV
KANFLSMMNWVKKQIPLPLGAVGNMRSLVYLDNLVDLILVCCQHPKAAGEIFLVSDNHDV
SLTTLLRTIAQAMQIRPRLLPIPQTGLQWLLRLLGKPELGQRLCGNLQLDIAHTQKTLHW
SPPVSFEQGIARTVNFYLSQSSK