Protein Info for CSW01_01300 in Vibrio cholerae E7946 ATCC 55056

Annotation: sugar ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00005: ABC_tran" amino acids 70 to 201 (132 residues), 67.9 bits, see alignment E=7.4e-23

Best Hits

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 100% identity to vco:VC0395_A2627)

MetaCyc: 40% identical to O antigen ABC transporter ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-125 [EC: 7.5.2.14]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>CSW01_01300 sugar ABC transporter (Vibrio cholerae E7946 ATCC 55056)
MVWSATSRTKYSIKKSFFGCSMIELSNVNLHYPVPGHFSHSLQTTISSKIGGVLGSSSAK
DKEMKYVHALRDINLKLEDSSRLGIIGHNGAGKTTLLRLLSQVYPPTSGKVTIEGKISAL
TDFTLGMDPNATGLKNIEFRLVFMGCTFKEAQQAVEEIVAFSELGEFINLPVRTYSTGMF
LRLAFAISTHFTPDILILDEVIGAGDETFREKALSRLESLIKKSRMVVLSSHDLNAIKQY
CDQAIVMEKGEIVFNGTPQSCIDYYLNSVKK