Protein Info for CSW01_01285 in Vibrio cholerae E7946 ATCC 55056

Annotation: perosamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 9 to 360 (352 residues), 452.5 bits, E=1.2e-139
• PF00155: Aminotran_1_2
  • amino acids 33 to 153 (121 residues), 33 bits, E=3.9e-12

Best Hits

Swiss-Prot: 100% identical to GDPPS_VIBCL: GDP-perosamine synthase (rfbE) from Vibrio cholerae

KEGG orthology group: K13010, perosamine synthetase (inferred from 100% identity to vco:VC0395_A2624)

MetaCyc: 100% identical to GDP-4-dehydro-6-deoxy-D-mannose-4-aminotransferase subunit (Vibrio cholerae O1)
RXN-8953 [EC: 2.6.1.102]

Predicted SEED Role

No annotation

MetaCyc Pathways

• GDP-D-perosamine biosynthesis (2/2 steps found)
• GDP-N-acetyl-α-D-perosamine biosynthesis (2/3 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (2/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.102

Protein Sequence (367 amino acids)

>CSW01_01285 perosamine synthetase (Vibrio cholerae E7946 ATCC 55056)
MIPVYEPSLDGNERKYLNDCIDSGWVSSRGKYIDRFETEFAEFLKVKHATTVSNGTVALH
LAMSALGITQGDEVIVPTFTYVASVNTIVQCGALPVFAEIEGESLQVSVEDVKRKINKKT
KAVMAVHIYGQACDIQSLRDLCDEHGLYLIEDCAEAIGTAVNGKKVGTFGDVSTFSFFGN
KTITSGEGGMVVSNSDIIIDKCLRLKNQGVVAGKRYWHDLVAYNYRMTNLCAAIGVAQLE
RVDKIIKRKRDIAEIYRSELAGLPMQVHKESNGTFHSYWLTSIILDQEFEVHRDGLMTFL
ENNDIESRPFFYPAHTLPMYEHLAEKTAFPLSNSYSHRGINLPSWPGLCDDQVKEICNCI
KNYFNCI