Protein Info for CSW01_01280 in Vibrio cholerae E7946 ATCC 55056

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01472: GDP-mannose 4,6-dehydratase
  • amino acids 4 to 354 (351 residues), 585.2 bits, E=2.1e-180
• PF01370: Epimerase
  • amino acids 6 to 253 (248 residues), 263 bits, E=4.7e-82
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 347 (341 residues), 512.5 bits, E=1.2e-157
• PF04321: RmlD_sub_bind
  • amino acids 7 to 162 (156 residues), 27.5 bits, E=3.4e-10

Best Hits

Swiss-Prot: 100% identical to GM4D_VIBCH: GDP-mannose 4,6-dehydratase (gmd) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to vcj:VCD_001374)

MetaCyc: 100% identical to GDP-D-mannose 4,6-dehydratase (Vibrio cholerae O1)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• GDP-D-perosamine biosynthesis (2/2 steps found)
• GDP-N-acetyl-α-D-perosamine biosynthesis (2/3 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (2/3 steps found)
• GDP-6-deoxy-D-talose biosynthesis (1/2 steps found)
• GDP-D-rhamnose biosynthesis (1/2 steps found)
• GDP-L-colitose biosynthesis (3/5 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (1/3 steps found)
• GDP-mycosamine biosynthesis (1/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Protein Sequence (373 amino acids)

>CSW01_01280 GDP-mannose 4,6-dehydratase (Vibrio cholerae E7946 ATCC 55056)
MNKKVALITGITGQDGSYLAEFLLEKGYEVHGIKRRSSLFNTQRVDHLYKDPHEEDVNFK
LHYGDLTDSSNLTRILAEVQPDEVYNLGAQSHVAVSFQSPEYTADVDAIGTLRLLEAIRF
LGLTKKTKFYQASTSELYGLVQEIPQKETTPFYPRSPYAVAKMYAYWITINYRESYGIYA
CNGILFNHESPRRGETFVTRKITRGMANIAQGLEKCLFMGNLDALRDWGHAKDYVKMQWM
MLQQDEPRDFVIATGVQYSVREFIDMSARELGIELEFVGKGVDEKAVVKSVIGTKAPAIK
VGDIIVAVDPAYFRPAEVETLLGDPSLAKKELGWVPEITLQQMVSEMVASDLEQAQSHAL
LKKHGYNVNVSVE