Protein Info for CSW01_01190 in Vibrio cholerae E7946 ATCC 55056

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 203 to 218 (16 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 8 to 132 (125 residues), 63.4 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 69% identical to Y653_HAEIN: Uncharacterized glycosyltransferase HI_0653 (HI_0653) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K12984, (heptosyl)LPS beta-1,4-glucosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to vcm:VCM66_0212)

Predicted SEED Role

"Lipopolysaccharide biosynthesis glycosyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>CSW01_01190 glycosyltransferase family 2 protein (Vibrio cholerae E7946 ATCC 55056)
MSKPTLAVALIVKNEARHLDECLQTVHDWVDEIVVLDSGSHDETEQVARRYTEKFYVNAK
WPGFGLQRQLAQSYVQSDYVLWLDADERVTPELKQSILQAVAANKPDTLYQFARLSWVFG
RFIRHSGWYPDRVLRLYPTQLTRYNDALVHEKVHVEPSMKVETLAGDAIHYTYNDVHHYL
VKSAGYAKAWADQRQAKGKKASLSQGIVHAVGCFLKMYLLKRGFLDGKQGFLIALLSAHS
TFVKYADLWARDNDEHYKR