Protein Info for CSW01_01130 in Vibrio cholerae E7946 ATCC 55056

Annotation: lipid A biosynthesis lauroyl acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 12 to 305 (294 residues), 249.3 bits, see alignment E=2.5e-78 TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 12 to 311 (300 residues), 421.4 bits, see alignment E=1.1e-130

Best Hits

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to vch:VC0213)

MetaCyc: 100% identical to myristoyl acyltransferase LpxL (Vibrio cholerae O1 biovar El Tor str. N16961)
RXN2G6Z-4 [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>CSW01_01130 lipid A biosynthesis lauroyl acyltransferase (Vibrio cholerae E7946 ATCC 55056)
MSTMSQDKYSKPEFSFSLLHPKYWGVWLGFGLLALLVNLLPYPVLLKIGRGLGQFSMRFG
KKRVHIARRNLELAFPTMSQSEIDAFVLENFKNTGAALIETGITWFWPTWRFKRILIDKD
TQAIRQHAKTGQGVLLCCVHALNLEITARAFAVLGIGGYGVYRPHSNPAYEFIQYRGRTR
NGNQLINRTDIKQMIRVLRQGERLFYLPDQDYGHNKSVFVPFFAVEEACTTTGTSILAYT
SHCAIVIGSGFRNAQGRYEIMADKSIEADYPQKDETAAAAYMNKFVEEIILRAPEQWMWL
HKRFKSLPDYELTNSRYQ