Protein Info for CSW01_01125 in Vibrio cholerae E7946 ATCC 55056

Annotation: lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02208: lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase
  • amino acids 14 to 316 (303 residues), 386.6 bits, E=4.2e-120
• PF03279: Lip_A_acyltrans
  • amino acids 15 to 308 (294 residues), 263.5 bits, E=1.2e-82

Best Hits

KEGG orthology group: K02560, lipid A biosynthesis (KDO)2-(lauroyl)-lipid iva acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to vco:VC0395_A2591)

MetaCyc: 100% identical to 3-hydroxylauroyl transferase LpxN (Vibrio cholerae O1 biovar El Tor str. N16961)
RXN2G6Z-5 [EC: 2.3.1.243]

Predicted SEED Role

"Lipid A biosynthesis (KDO) 2-(lauroyl)-lipid IVA acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

• (Kdo)₂-lipid A biosynthesis (E. coli) (2/2 steps found)
• Kdo-lipid A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (2/2 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (12/17 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (12/25 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.243

Protein Sequence (325 amino acids)

>CSW01_01125 lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase (Vibrio cholerae E7946 ATCC 55056)
MSDQDNGIARHLHNPQFEWRFLHPKHWGTWIGIAFAALLAFIPWRLRDRLAKPLVPLIIK
KNGRVVRRARVNLAYCFPEKSEQEREQILHDTFVKASQFMLGYSELLVRSTRYNNARGEL
IGEENLLPLLDSGERVILLVPHSWAIDYAAVMLAARGYKVANIMKPQRNPIADWLMHVQR
MQYGGRIFTRESGIKPFLRSIQSGYVGYWVPDEDHGPQNSVFVPFFATEKATLKGFGKMA
KLCKAHVVPLMSCYNSDSGRYEVHILPALQNFPTGDEEADALAMNRAIEALVTPQPEQYM
WNLSLLKTQRDGSEIYDNSHHGDQS