Protein Info for CSW01_01095 in Vibrio cholerae E7946 ATCC 55056

Annotation: N-acetylmuramic acid 6-phosphate etherase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00274: N-acetylmuramic acid 6-phosphate etherase" amino acids 13 to 302 (290 residues), 429.5 bits, see alignment E=2.6e-133 PF13580: SIS_2" amino acids 47 to 171 (125 residues), 36 bits, see alignment E=1.7e-12 PF22645: GKRP_SIS_N" amino acids 54 to 161 (108 residues), 75.8 bits, see alignment E=5.7e-25 PF22198: GKRP_SIS_2" amino acids 55 to 114 (60 residues), 30.3 bits, see alignment E=8.6e-11 PF01380: SIS" amino acids 133 to 216 (84 residues), 35.1 bits, see alignment E=2.8e-12

Best Hits

Swiss-Prot: 100% identical to MURQ1_VIBCH: N-acetylmuramic acid 6-phosphate etherase 1 (murQ1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 100% identity to vcj:VCD_001410)

MetaCyc: 64% identical to N-acetylmuramic acid 6-phosphate etherase (Escherichia coli K-12 substr. MG1655)
RXN0-4641 [EC: 4.2.1.126]

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.-.-, 4.2.1.126

Use Curated BLAST to search for 4.2.-.- or 4.2.1.126

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>CSW01_01095 N-acetylmuramic acid 6-phosphate etherase (Vibrio cholerae E7946 ATCC 55056)
MPRSLMKIDLTRLVTESRNPASEQIDTLPTLDMLKVINQQDQLVALAVAQTLPQVAQAVE
AIATAFAQGGRLIYMGAGTSGRLGILDASECPPTYGSQPEQVIGLIAGGHTAILKAVENA
EDNRELGQSDLKALHLSEKDVLVGIAASGRTPYVIAGMEYARSVGATVVSLACNPGCPME
AYADIVITPVVGAEVVTGSSRMKAGTAQKLVLNMLTTGAMIKSGKVFGNLMVDVEATNAK
LIQRQTNIVVEATGVSAEQAEAALAACGRHCKTAILMILGGFSAEQAAQKLTQHQGFIRA
ALNQE