Protein Info for CSW01_01040 in Vibrio cholerae E7946 ATCC 55056

Annotation: protein RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 155 to 171 (17 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details TIGR00688: protein RarD" amino acids 11 to 265 (255 residues), 278 bits, see alignment E=3.7e-87 PF00892: EamA" amino acids 12 to 145 (134 residues), 53.1 bits, see alignment E=2.2e-18 amino acids 156 to 288 (133 residues), 28.4 bits, see alignment E=8.9e-11

Best Hits

Swiss-Prot: 100% identical to Y195_VIBCH: Uncharacterized transporter VC_0195 (VC_0195) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to vco:VC0395_A2575)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>CSW01_01040 protein RarD (Vibrio cholerae E7946 ATCC 55056)
MFMTPDQQDAKKGILLAISAYTMWGIAPIYFKALGAVSALEILSHRVVWSFVLLAVLIHL
GRRWRSVVGVVHTPRKFWLLLVTALLVGGNWLIFIWSINANHMLDASLGYYINPLLNVLL
GMLFLGERLRKLQWFAVALAAIGVGIQLVVFGSVPIVAIALATSFGFYGLLRKKIQVDAQ
TGLFLETLFMLPAAAIYLIWLADTPTSDMALNTWQLNLLLVCAGVVTTLPLLCFTGAAAR
LKLSTLGFFQYIGPSLMFLLAVLVYGEAFTSDKAITFAFIWSALVIFSVDGLKAGHAARR
AR