Protein Info for CSW01_00960 in Vibrio cholerae E7946 ATCC 55056

Annotation: patatin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K06900, (no description) (inferred from 100% identity to vcj:VCD_000627)

MetaCyc: 100% identical to cGAMP-activated phospholipase CapV (Vibrio cholerae O1 biovar El Tor str. N16961)
Phospholipase A(2). [EC: 3.1.1.4]

Predicted SEED Role

"patatin-related protein"

MetaCyc Pathways

phospholipid remodeling (phosphatidate, yeast) (1/2 steps found)
phosphatidylcholine acyl editing (2/4 steps found)
phospholipid remodeling (phosphatidylethanolamine, yeast) (2/4 steps found)
phospholipases (1/5 steps found)
anandamide biosynthesis II (2/8 steps found)
anandamide biosynthesis I (3/12 steps found)
peptido-conjugates in tissue regeneration biosynthesis (3/17 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>CSW01_00960 patatin (Vibrio cholerae E7946 ATCC 55056)
MPNPPEYEHLKNQVRILSLNGGGARGLFTISLLAEIERIIEEKQGINGFKVGDYFDLITG
TSIGGILALGLAYGKSARELEDVFRKQAGYIFPEQKYPRFFPVFRRRYRLARGPLYDSKP
LAKTIASMVGEESTFNDLKCRVLIPTVNLSTGKPQFFKTPHNPEFHRDGRIKLIDAALAT
SAAPTYFAPHYCVDLDSYFADGGLVANNPSFIGLHEVFRDMATDFPEAKVSDVKILNVGT
LGEEYSLSPSSLAGKSGYLGLWGMGERLVLSAMAANQELHKAMLLREFATHDAIGNFVRL
DNNIPHEAASDITLDNASASSLSNLASRGRQLATEEFTKNKALADFFKVPARKFK