Protein Info for CSW01_00925 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 271 to 298 (28 residues), see Phobius details PF12911: OppC_N" amino acids 18 to 69 (52 residues), 38.9 bits, see alignment 6.3e-14 PF00528: BPD_transp_1" amino acids 116 to 309 (194 residues), 109.6 bits, see alignment E=1.6e-35

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to vco:VC0395_A2566)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>CSW01_00925 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MSAVSIAPSRWERFKQSDFLYYFLRDKVAMSSFAVFVLFVIVAISAPLIAPTNPYDLSSI
DIMDAELPPSWMEGGNEHFLLGTDEQGRDIFSTILYGSRLSLTIGFLAVGLQLTLGIVIG
LSAGYFGGRIDSFLMRFADIQLSFSTMMVAIIVSAIFKASFGGEFFSQYAVVMLVVIIGV
AEWPQYARTVRASVLAEKKKEYVEAARVMGFKAPRIMFRHILPNCLSPILVISTVQVANA
IMSEAALSFLGLGLPVDQPSLGSLISIGFTYIFSGAWWITAFPGIVLVLLVLVINLLGDW
LRDVFNPKIYKG