Protein Info for CSW01_00800 in Vibrio cholerae E7946 ATCC 55056

Annotation: glutamate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 TIGR00067: glutamate racemase" amino acids 9 to 225 (217 residues), 237.1 bits, see alignment E=1.1e-74 PF01177: Asp_Glu_race" amino acids 17 to 215 (199 residues), 94.7 bits, see alignment E=3.6e-31

Best Hits

Swiss-Prot: 100% identical to MURI_VIBC3: Glutamate racemase (murI) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 100% identity to vch:VC0158)

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>CSW01_00800 glutamate racemase (Vibrio cholerae E7946 ATCC 55056)
MSSPSFPRVLIFDSGVGGLSVYREIEARLPQLNYIYLFDNAAYPYGELTQETLIARVDTL
VTRMVEQERIDLVVIACNTASTIVLPVLRAKLTIPVVGVVPAIKPASLIASKAIGLIATP
ATVKRQYTQELIRDFSANKNVELLGSTRLVNMAEEKLRGKPLDLEELASILQPLKNTIDV
AVLGCTHFPLIKEEIQQVLGEQVQLIDSGLAIARRVQELLGIEQAVGAKQKHRIYASAPP
WEESALNIKLEQLGFNPVQPFLHPI