Protein Info for CSW01_00795 in Vibrio cholerae E7946 ATCC 55056

Annotation: alkaline serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05922: Inhibitor_I9" amino acids 52 to 129 (78 residues), 45 bits, see alignment E=2.1e-15 PF00082: Peptidase_S8" amino acids 169 to 401 (233 residues), 164.2 bits, see alignment E=6.3e-52 PF04151: PPC" amino acids 457 to 522 (66 residues), 58.3 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 56% identical to PROA_VIBAL: Alkaline serine exoprotease A (proA) from Vibrio alginolyticus

KEGG orthology group: K14645, serine protease [EC: 3.4.21.-] (inferred from 100% identity to vch:VC0157)

Predicted SEED Role

"Alkaline serine exoprotease A precursor (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>CSW01_00795 alkaline serine protease (Vibrio cholerae E7946 ATCC 55056)
MFKKFLSLCIVSTFSVAATSALAQPNQLVGKSSPQQLAPLMKAASGKGIKNQYIVVLKQP
TTIMSNDLQAFQQFTQRSVNALANKHALEIKNVFDSALSGFSAELTAEQLQALRADPNVD
YIEQNQIITVNPIISASANAAQDNVTWGIDRIDQRDLPLNRSYNYNYDGSGVTAYVIDTG
IAFNHPEFGGRAKSGYDFIDNDNDASDCQGHGTHVAGTIGGAQYGVAKNVNLVGVRVLGC
DGSGSTEAIARGIDWVAQNASGPSVANLSLGGGISQAMDQAVARLVQRGVTAVIAAGNDN
KDACQVSPAREPSGITVGSTTNNDGRSNFSNWGNCVQIFAPGSDVTSASHKGGTTTMSGT
SMASPHVAGVAALYLQENKNLSPNQIKTLLSDRSTKGKVSDTQGTPNKLLYSLTDNNTTP
NPEPNPQPEPQPQPDSQLTNGKVVTGISGKQGELKKFYIDVPAGRRLSIETNGGTGNLDL
YVRLGIEPEPFAWDCASYRNGNNEVCTFPNTREGRHFITLYGTTEFNNVSLVARY