Protein Info for CSW01_00690 in Vibrio cholerae E7946 ATCC 55056

Annotation: homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details PF01810: LysE" amino acids 15 to 202 (188 residues), 122.6 bits, see alignment E=7.3e-40

Best Hits

Swiss-Prot: 100% identical to Y136_VIBCH: Uncharacterized membrane protein VC_0136 (VC_0136) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 100% identity to vcm:VCM66_0136)

MetaCyc: 50% identical to L-homoserine/L-homoserine lactone/L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN-242A; TRANS-RXN0-0244

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>CSW01_00690 homoserine/homoserine lactone efflux protein (Vibrio cholerae E7946 ATCC 55056)
MDIHVWLAYLLTAVVFSLAPGSGTVNSISNGLSYGTRHSLGAIIGLQIGLACHIVLVGIG
IGALVAQSALAFTLIKWIGAAYLVWLGIQKWRDRAPLTATTTSHELSQAALLRKAVLINL
TNPKSIVFLVALFPQFIDPTRDHWPQFLVLGITTVTIDAIVMFGYTALAAQLGRYIRSPN
IMTRMNKLFGSMFMGCGMLLATAKA