Protein Info for CSW01_00625 in Vibrio cholerae E7946 ATCC 55056

Annotation: iron donor protein CyaY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01491: Frataxin_Cyay
  • amino acids 1 to 100 (100 residues), 109.9 bits, E=3.6e-36
• TIGR03421: iron donor protein CyaY
  • amino acids 2 to 103 (102 residues), 139.2 bits, E=2.2e-45

Best Hits

Swiss-Prot: 100% identical to CYAY_VIBCH: Iron-sulfur cluster assembly protein CyaY (cyaY) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06202, CyaY protein (inferred from 100% identity to vco:VC0395_A2396)

MetaCyc: 45% identical to frataxin CyaY (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly" in subsystem Biogenesis of cytochrome c oxidases

Protein Sequence (104 amino acids)

>CSW01_00625 iron donor protein CyaY (Vibrio cholerae E7946 ATCC 55056)
MNETEFHQLVDSQLERIEAAIDEAGADIDYETSGNVMTLEFDDGSQIIINRQEPMREIWL
ASKSGGYHFKSIDGEWICSKTGLELLTLLKQECDKHADEPIDWV