Protein Info for CSW01_00450 in Vibrio cholerae E7946 ATCC 55056

Annotation: SCP2 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF02036: SCP2" amino acids 21 to 117 (97 residues), 77.6 bits, see alignment E=4e-26

Best Hits

Swiss-Prot: 38% identical to UBIJ_SALTY: Ubiquinone biosynthesis protein UbiJ (ubiJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03690, hypothetical protein (inferred from 100% identity to vcm:VCM66_0084)

MetaCyc: 37% identical to ubiquinone biosynthesis accessory factor UbiJ (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein YigP (COG3165) clustered with ubiquinone biosynthetic genes" in subsystem Ubiquinone Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>CSW01_00450 SCP2 domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MSLLATMPLSPLLTAVIETTLNTLINDDPALGRKLLRLKGKVISLHLRELNQSLTFVFSQ
RIDVMTGFEGQPDCYLALNLSILPQLREQANITQLIKQDKLELEGDIQLAQKFSELMTDC
KPDVEEWLSRITGDVVAHSVVHGVKSIVGALKQQAHKHQNHLAQVLTEEWRIAPPPLEIA
YFCDQVDDVKSHAARLEARLNQLLEKA