Protein Info for CSW01_00445 in Vibrio cholerae E7946 ATCC 55056

Annotation: ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF01209: Ubie_methyltran" amino acids 29 to 259 (231 residues), 345.1 bits, see alignment E=6e-107 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 34 to 259 (226 residues), 278.4 bits, see alignment E=1.7e-87 PF13489: Methyltransf_23" amino acids 57 to 241 (185 residues), 68.7 bits, see alignment E=1.8e-22 PF01135: PCMT" amino acids 71 to 177 (107 residues), 35.9 bits, see alignment E=2.5e-12 PF13847: Methyltransf_31" amino acids 72 to 238 (167 residues), 86.1 bits, see alignment E=7.7e-28 PF13649: Methyltransf_25" amino acids 76 to 173 (98 residues), 85.8 bits, see alignment E=9.9e-28 PF08241: Methyltransf_11" amino acids 77 to 177 (101 residues), 82.9 bits, see alignment E=7.4e-27 PF08242: Methyltransf_12" amino acids 77 to 175 (99 residues), 54.4 bits, see alignment E=6e-18

Best Hits

Swiss-Prot: 100% identical to UBIE_VIBC3: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to vcj:VCD_001550)

MetaCyc: 80% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>CSW01_00445 ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Vibrio cholerae E7946 ATCC 55056)
MTDTNVLANSATDNQETTHFGFETVRKDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLW
KRFTIDCSGARPGQRILDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDS
GVVGNVHYVQANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEF
SKPILEPLSKLYDTYSFHILPKMGQLIANDADSYRYLAESIRMHPDQETLKGMMEEAGFE
QTTYYNLTGGIVALHRGYKF