Protein Info for CSW01_00430 in Vibrio cholerae E7946 ATCC 55056

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01266: DAO" amino acids 9 to 107 (99 residues), 33.2 bits, see alignment E=2e-11 PF12831: FAD_oxidored" amino acids 9 to 141 (133 residues), 32.2 bits, see alignment E=3.3e-11 PF03486: HI0933_like" amino acids 9 to 396 (388 residues), 331.2 bits, see alignment E=1.8e-102 PF07992: Pyr_redox_2" amino acids 9 to 166 (158 residues), 34.6 bits, see alignment E=6.7e-12 PF01134: GIDA" amino acids 9 to 39 (31 residues), 24.1 bits, see alignment (E = 8.4e-09) PF00890: FAD_binding_2" amino acids 9 to 52 (44 residues), 36.2 bits, see alignment 2e-12 TIGR00275: flavoprotein, HI0933 family" amino acids 10 to 396 (387 residues), 428.3 bits, see alignment E=1.4e-132 PF13450: NAD_binding_8" amino acids 12 to 43 (32 residues), 31.3 bits, see alignment (E = 9.3e-11) PF22780: HI0933_like_1st" amino acids 193 to 343 (151 residues), 167.1 bits, see alignment E=1.4e-52

Best Hits

Swiss-Prot: 62% identical to YHIN_ECOLI: Uncharacterized protein YhiN (yhiN) from Escherichia coli (strain K12)

KEGG orthology group: K07007, (no description) (inferred from 100% identity to vcj:VCD_001547)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>CSW01_00430 NAD(P)/FAD-dependent oxidoreductase (Vibrio cholerae E7946 ATCC 55056)
MAVMSKTVDVVIIGAGAAGLMCAAQAARRGRQVLLLDHAKKPGRKILISGGGRCNFTNYD
VSAANYLCQNPHFVKSALSQYTNWDFISLVSKYGIAFEERDHGQLFCLDSAKEIVDMLLS
ECDQPNIEQRYQVEISAIAHTEQGFTLQTTIGEIECASLVVATGGLSMPKLGATPFGYKI
AEQFGLPVISTSAGLVPFTLHVQDKEDFAPLSGVAIPVEMRAECGKTFKEALLFTHRGLS
GPAVLQISSYWTPGQTITTNLVPDVDLAELLSSEKEAHPNQSLKNTLSKVLPKRLVEVLI
ERQLFADKPLKQYSPKELDAVQTRLEQWSIVPNGTEGYRTAEVTLGGVDTDCLSSKTMEC
KTVKGLFFIGEVMDVTGWLGGYNFQWAWSSGYVAGQWV