Protein Info for CSW01_00355 in Vibrio cholerae E7946 ATCC 55056

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05690: ThiG
  • amino acids 3 to 247 (245 residues), 378.9 bits, E=9.9e-118

Best Hits

Swiss-Prot: 100% identical to THIG_VIBC3: Thiazole synthase (thiG) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 100% identity to vcj:VCD_001533)

MetaCyc: 72% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Protein Sequence (256 amino acids)

>CSW01_00355 thiazole synthase (Vibrio cholerae E7946 ATCC 55056)
MLKIADKTFQSRLFTGTGKFSNRHVMAEALAASGSELVTMALKRIDLAQRDDDILAPLLS
MQMNLLPNTSGAKNAADAVYAAELAREALATNWLKLEIHPDPKYLMPDPIETLLAAEQLV
KQGFIVLPYCHADPVLCKRLEEVGCAAVMPLGSPIGSNQGLASKTFLEIIIDQAKVPVIV
DAGIGSPSDAAQAMELGADAVLVNTAIAAAHDPIAMAKAFKLAVEAGRMAYESGLPSRVK
MATASSPLTGFLDFVS