Protein Info for CSW01_00225 in Vibrio cholerae E7946 ATCC 55056

Annotation: 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 1 to 123 (123 residues), 95 bits, E=1.5e-30
• TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • amino acids 4 to 425 (422 residues), 516.2 bits, E=4.3e-159
• PF01189: Methyltr_RsmB-F
  • amino acids 237 to 422 (186 residues), 237.9 bits, E=2.5e-74
• PF01728: FtsJ
  • amino acids 243 to 373 (131 residues), 30.6 bits, E=9.8e-11
• PF13847: Methyltransf_31
  • amino acids 244 to 373 (130 residues), 37.8 bits, E=4.9e-13
• PF13649: Methyltransf_25
  • amino acids 247 to 318 (72 residues), 31 bits, E=1e-10

Best Hits

Swiss-Prot: 100% identical to RSMB_VIBCH: Ribosomal RNA small subunit methyltransferase B (rsmB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to vch:VC0044)

MetaCyc: 62% identical to 16S rRNA m5C967 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11591 [EC: 2.1.1.176]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.176

Protein Sequence (426 amino acids)

>CSW01_00225 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB (Vibrio cholerae E7946 ATCC 55056)
MNVRAAAASALYQVVDLGHSLSNALPAAQQQIRPRDHALLQEICYGVLRQLPRLESISQA
LMGKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQDLKGPRLRGLINAVLRN
YQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLRVNHQHH
TRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQLALTYLA
PQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLELTAQVICGD
ARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREILDAMWQQ
LKPGGSLVYATCSITPQENRLQVKAFLERTPDARLVGSEPAQPGRQILPGEEAMDGFYYA
VLSKQH