Protein Info for CSW01_00215 in Vibrio cholerae E7946 ATCC 55056

Annotation: potassium uptake protein TrkH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details amino acids 388 to 412 (25 residues), see Phobius details amino acids 454 to 479 (26 residues), see Phobius details PF02386: TrkH" amino acids 44 to 475 (432 residues), 184.4 bits, see alignment E=1.6e-58 TIGR00933: potassium uptake protein, TrkH family" amino acids 85 to 464 (380 residues), 354.1 bits, see alignment E=5.3e-110

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to vch:VC0042)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>CSW01_00215 potassium uptake protein TrkH (Vibrio cholerae E7946 ATCC 55056)
MLNLRPITFIIGLVLSKLALFMYVPTLVAFFTGSGGFLDFAQAVIITHLVAFLCLSIGRT
EHFRLNVRDMFLITSLVWTIASAFAALPFVFINHISFTDAYFETMSGLTTTGSTVLSGLD
DMPPSILLWRSILQWLGGVGFIVMAVAVLPMLNVGGMKLFQTESSDWSDKSSPRAKTVAK
NIVAVYLVLTGLCFLSYIATGMTPFEAINHAFTTLSTGGYSTSDSSMNRFSHGAHWVGTL
FMFLGGLPFLLFVQALRKQSARALLKDEQVRGFFWLFMISSLLVAGWLWLKNDYAILDAL
RVSMFNIVSVVTTTGYGLDDFTAWGALPSTIFAFLLMAGACSGSTSGGIKVFRFQIAMAL
LKKQLLNLIHPSGIFIQRYNKRPVNEEIIRSVVAFGLTFFITIVVLAGALSAMGLDSVTS
ISGAVTAVANVGPGMGSIIGPTGNFAPLPDAAKWLLSFGMLMGRLEILTILVLFFPAFWR
H