Protein Info for CSW01_00205 in Vibrio cholerae E7946 ATCC 55056

Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details PF03006: HlyIII" amino acids 9 to 205 (197 residues), 135.8 bits, see alignment E=9.2e-44 TIGR01065: channel protein, hemolysin III family" amino acids 11 to 212 (202 residues), 234.8 bits, see alignment E=3.4e-74

Best Hits

Swiss-Prot: 73% identical to YQFA_ECOLI: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli (strain K12)

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to vcj:VCD_001509)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>CSW01_00205 hemolysin III family protein (Vibrio cholerae E7946 ATCC 55056)
MSMSNSYGFKEEVANAISHGVGLILGIVGLVLLLVKAVDQQADALTITSMSIYGGSMIAL
FLASTLYHAIPYQRAKRWLKTFDHCAIYLLIAGSYTPFLLVSLRTPLAVGLMIVIWSLAL
IGILMKIAFVYRFKKLSLVTYLTMGWLSLIVIYQLAIHLEVGGLTLLAAGGLIYSLGVIF
YVAKRIPYNHAIWHAFVLAGCACHFLAIYLYVEPI