Protein Info for CSW01_00130 in Vibrio cholerae E7946 ATCC 55056

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 122 to 140 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details TIGR02823: putative quinone oxidoreductase, YhdH/YhfP family" amino acids 4 to 326 (323 residues), 458 bits, see alignment E=6.9e-142 PF08240: ADH_N" amino acids 28 to 115 (88 residues), 46 bits, see alignment E=8e-16 PF01370: Epimerase" amino acids 151 to 244 (94 residues), 20.9 bits, see alignment E=3.1e-08 PF00107: ADH_zinc_N" amino acids 159 to 272 (114 residues), 46.9 bits, see alignment E=3.9e-16

Best Hits

Swiss-Prot: 68% identical to ACUI_ECOLI: Probable acrylyl-CoA reductase AcuI (acuI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_001494)

MetaCyc: 68% identical to acrylyl-CoA reductase (Escherichia coli K-12 substr. MG1655)
RXN-9087 [EC: 1.3.1.84]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>CSW01_00130 oxidoreductase (Vibrio cholerae E7946 ATCC 55056)
MFNALLLTQQDKITHATVTQINDDQLPAGNVTVAVNYSSLNYKDGLAITGKGKIIREFPM
VPGIDFAGTVLESADARYQVGDAVVLTGWGVGENHWGGMAQKARLNADWLVKLPQGLTSQ
QAMMIGTAGFTAMLCVQALIDGGIKPEDGEILVTGASGGVGSVAVTLLAQLGYKVVAVTG
RVAQNGPLLEQLGASRVIDRQEFSEASRPLEKQLWVGAVDTVGSKVLAKVLAQMHYNGVV
AACGLAGGFDLPTTVMPFILRNVRLQGVDSVSCPVEKRLAAWKKLAELLPASYYAQACHE
ISLSQVPEYAEAITNGQVTGRVVVKL