Protein Info for CSW01_00110 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details PF01169: GDT1" amino acids 7 to 80 (74 residues), 73.8 bits, see alignment E=5.7e-25 amino acids 103 to 178 (76 residues), 71.8 bits, see alignment E=2.5e-24

Best Hits

Swiss-Prot: 100% identical to MNEA_VIBC3: Putative manganese exporter (mneA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2497)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>CSW01_00110 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MSVLAISITTVALAEIGDKTQLLSLLLASRYRKPIPIIAAIFLATLANHALAAWLGVVVA
DYLSPDILKWVLVVSFLAMAGWILIPDKLDGEESISTRGPFVASFIAFFMAEIGDKTQIA
TSILGAQYADALSWVIVGTTLGMLLANVPVVLIGKLSADKMPLGLIRKVTAGLFLLMALA
TAFF