Protein Info for CSW01_00085 in Vibrio cholerae E7946 ATCC 55056

Annotation: heat-shock protein Hsp20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF00011: HSP20" amino acids 42 to 137 (96 residues), 74.3 bits, see alignment E=3.8e-25

Best Hits

Swiss-Prot: 60% identical to IBPA_PECCP: Small heat shock protein IbpA (ibpA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K04080, molecular chaperone IbpA (inferred from 100% identity to vco:VC0395_A2501)

Predicted SEED Role

"16 kDa heat shock protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>CSW01_00085 heat-shock protein Hsp20 (Vibrio cholerae E7946 ATCC 55056)
MRTVDFTPLYRNAIGFDRLLNMMENSAAKNAQGGYPPYNIEQKEDNQYRITMAVAGFGDE
EIDITQQENTLIVRGERKPEESKNYIYQGIAERDFERKFQLADYVKVTGATMEHGLLHID
LEREIPEAMQPRKIAINGKHLLENK