Protein Info for CSW01_00065 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 356 (356 residues), 388.6 bits, see alignment E=1.5e-120 PF13175: AAA_15" amino acids 1 to 77 (77 residues), 44.7 bits, see alignment E=2.9e-15 PF02463: SMC_N" amino acids 3 to 360 (358 residues), 142.2 bits, see alignment E=3.3e-45 PF13476: AAA_23" amino acids 5 to 51 (47 residues), 35.8 bits, see alignment 2.7e-12 PF13304: AAA_21" amino acids 25 to 46 (22 residues), 30.2 bits, see alignment (E = 9.2e-11)

Best Hits

Swiss-Prot: 100% identical to RECF_VIBCH: DNA replication and repair protein RecF (recF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 100% identity to vco:VC0395_A2505)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>CSW01_00065 DNA replication and repair protein RecF (Vibrio cholerae E7946 ATCC 55056)
MPLSRLMIQQFRNIKACDIRLSAGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSSLTGRI
IQNECSELFVHGRICEHSLSSDQFELPVGINKQRDGSTEVKIGGQTGQKLAQLAQILPLQ
LIHPEGFELLTDGPKQRRAFIDWGVFHTEPAFFDAWGRFKRLSKQRNALLKSAQSYRELS
YWDQELARLAEQIDQWRESYVNQLKNVAEQLCRTFLPEFDIDLKYYRGWEKDQPYQSILE
KNFERDQQLGYTFSGPNKADLRIKVNATPVEDVLSRGQLKLMVCALRVAQGQHLTELTGK
QCIYLIDDFASELDSLRRQRLADSLKGTGAQVFVSSITESQVADMLDESSKTFHVAHGVI
EQG