Protein Info for CSW01_00050 in Vibrio cholerae E7946 ATCC 55056

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 25 to 243 (219 residues), 130.6 bits, see alignment E=1.6e-42

Best Hits

Swiss-Prot: 84% identical to PATH_VIBHA: Putative amino-acid ABC transporter-binding protein PatH (patH) from Vibrio harveyi

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to vcj:VCD_001479)

Predicted SEED Role

"Amino acid ABC transporter, periplasmic amino acid-binding portion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>CSW01_00050 amino acid ABC transporter substrate-binding protein (Vibrio cholerae E7946 ATCC 55056)
MKHWFNIALAALALSSATVQAATEVKVGMSGRYFPFTFVKQDELQGFEVDVWNEIGKRND
YKVEFVTANFSGLLGLLETGRIDTISNQITITDARKAKYLFSDPYVIDGAQITVRKGNEA
IKGIDDLAGKTVAVNLGSNFEQLLRNHDKDGKINIKTYDTGIEHDVALGRADAFVMDRLS
ALELIEKTGLPLQLAGSPFETIENAWPFVNNEKGQQLQGEVNKALAAMRADGTLSQIALK
WFGTDISQ