Protein Info for CCNA_03872 in Caulobacter crescentus NA1000

Annotation: tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF10396: TrmE_N" amino acids 14 to 126 (113 residues), 129.1 bits, see alignment E=2.5e-41 TIGR00450: tRNA modification GTPase TrmE" amino acids 19 to 456 (438 residues), 289.3 bits, see alignment E=6.1e-90 PF12631: MnmE_helical" amino acids 129 to 453 (325 residues), 167 bits, see alignment E=1.7e-52 TIGR00231: small GTP-binding protein domain" amino acids 223 to 348 (126 residues), 58 bits, see alignment E=9.7e-20 PF01926: MMR_HSR1" amino acids 224 to 321 (98 residues), 73.7 bits, see alignment E=3.2e-24 PF02421: FeoB_N" amino acids 224 to 316 (93 residues), 35.1 bits, see alignment E=2.4e-12

Best Hits

Swiss-Prot: 100% identical to MNME_CAUVC: tRNA modification GTPase MnmE (mnmE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 100% identity to ccs:CCNA_03872)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GW34 at UniProt or InterPro

Protein Sequence (456 amino acids)

>CCNA_03872 tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase (Caulobacter crescentus NA1000)
MARASSATDRMTDTIFALATAAGRSAVAVVRVSGPRSSEIAAALCGRLPSPRLASVRTLK
HNGVALDAALVLRFEKPASYTGEDSVEFHVHGGRAVVEALLAALSELGARLAEAGEFTRR
AFENGKLDLAQAEGVADLIDAETEAQRRQALGQVGGALSQRYDRWRDLLVQALAMLEAAV
DFPDEDLPEEVAERARPGLRQLSAELNAALADVSRGRRVRDGFRIALIGAPNAGKSTLLN
GLAERDAAIVTDVAGTTRDVIEVPLVLGGYKVLVADTAGIRETADVIEAEGVRRAKAWAE
AADLRLWVVDGFHVKQADARPEAIRVGDWLILNKTDIADADASAHVAERWAGEGLTVLHI
AGTSAEGPEALRAALASHVADALSGAEFPAATRLRHAERLSEARSYLERALSDVGLEVEL
AAEDVRLAARALERISGRIDPEDVLGRVFSTFCIGK