Protein Info for CCNA_03810 in Caulobacter crescentus NA1000

Annotation: organic solvent resistance transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00005: ABC_tran" amino acids 23 to 173 (151 residues), 106.6 bits, see alignment E=8e-35

Best Hits

Swiss-Prot: 37% identical to MLAF_HAEIN: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 100% identity to ccr:CC_3696)

MetaCyc: 35% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CG33 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CCNA_03810 organic solvent resistance transport system ATP-binding protein (Caulobacter crescentus NA1000)
MTSQVPKLAWKGVTKQFGDRKVLDQLDLSVAPGRSLVIIGGSGQGKSVTIKTALGLLRPE
AGAIELDGKNVVGLSETQRRKLFSRVGVLFQGAALFDSLTIWENVAFRLINADGVPRRKA
RDRAIEALEQVRLSADVAERFPSELSGGMQKRAGLARAVVARPEILFFDEPTTGLDPITA
AAINQLISDQVRRLGSTAVSITHDLASAQTIGDEIAMLHGGKIIWRGPAAELATTDNPYV
RQFVEGRAEGPISETH