Protein Info for CCNA_03788 in Caulobacter crescentus NA1000

Annotation: thiol:disulfide interchange protein tlpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 9 to 166 (158 residues), 134.2 bits, see alignment E=1.7e-43 PF08534: Redoxin" amino acids 37 to 160 (124 residues), 57.4 bits, see alignment E=3e-19 PF00578: AhpC-TSA" amino acids 37 to 150 (114 residues), 41.4 bits, see alignment E=2.7e-14 PF13098: Thioredoxin_2" amino acids 59 to 169 (111 residues), 30.2 bits, see alignment E=9.7e-11

Best Hits

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 100% identity to ccr:CC_3674)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CED5 at UniProt or InterPro

Protein Sequence (170 amino acids)

>CCNA_03788 thiol:disulfide interchange protein tlpA (Caulobacter crescentus NA1000)
MKRWLAFSPLIVLVALAVLFAGYALQRDPRVQPQALVGKPMPALMLPDLDTGRPAPLRQT
GEGPILVNFFASWCAPCEVEHPQLMALKAQGVTVVGIAYKDAPANTQAFLTRLGDPFAAK
RVDRDGRAGLEFGVTGVPETYLVGSDGVIIAKHTGPLTPDAAEDLLKQAK