Protein Info for CCNA_03729 in Caulobacter crescentus NA1000

Annotation: transaldolase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR00875: fructose-6-phosphate aldolase" amino acids 1 to 210 (210 residues), 281.1 bits, see alignment E=2.4e-88 PF00923: TAL_FSA" amino acids 3 to 215 (213 residues), 205.4 bits, see alignment E=6.2e-65

Best Hits

Swiss-Prot: 100% identical to TAL_CAUVN: Probable transaldolase (tal) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 99% identity to cse:Cseg_4100)

MetaCyc: 31% identical to fructose-6-phosphate aldolase 1 (Escherichia coli K-12 substr. MG1655)
4.1.2.-

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H6D3 at UniProt or InterPro

Protein Sequence (217 amino acids)

>CCNA_03729 transaldolase-like protein (Caulobacter crescentus NA1000)
MQIFLDSTDTKVIADLASTGLIDGVTTNPTLIAKSGRPMLEVIAEICDIVPGPISAEVAA
TTADAMIAEGQKLAKIAPNVVVKIPLTRDGLIACAAFADEEIKTNVTLCFSPTQALLAAK
AGATYISPFIGRLDDYGFDGMDLIRDIRAIYDNYGYETEILAASVRNAAHVKEAAIVGAD
VVTIPPAVFSDLYKHPLTDKGLEQFLKDWASTGQSIL