Protein Info for CCNA_03703 in Caulobacter crescentus NA1000

Annotation: cytidylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00017: cytidylate kinase
  • amino acids 2 to 198 (197 residues), 165.2 bits, E=9.1e-53
• PF02224: Cytidylate_kin
  • amino acids 5 to 201 (197 residues), 179.2 bits, E=4.5e-57

Best Hits

Swiss-Prot: 100% identical to KCY_CAUVC: Cytidylate kinase (cmk) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 100% identity to ccs:CCNA_03703)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• CMP phosphorylation (2/2 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (6/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Sequence Analysis Tools

See B8H6A7 at UniProt or InterPro

Protein Sequence (213 amino acids)

>CCNA_03703 cytidylate kinase (Caulobacter crescentus NA1000)
MGFVIAVDGPAASGKGTVAGRLAALYGYPLLDTGLLYRAVGVAILDGAGDLDDPIAAEAV
ARALDLSALDRAEVRTRAAGEAASRCAVHPGVRAALLDLQQTFAAREPGSVIDGRDIGTV
IAPHAPAKLYVTARPEVRAERRWKQLVGQGEDVAFEDILADIHKRDARDGGRKDAPMTQA
PDAVLLDTSEMTIEQAFDAARRIVEDARARHRL