Protein Info for CCNA_03695 in Caulobacter crescentus NA1000
Annotation: aldehyde dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 81% identical to ALDH_PARDP: Aldehyde dehydrogenase (adh) from Paracoccus denitrificans (strain Pd 1222)
KEGG orthology group: K00128, aldehyde dehydrogenase (NAD+) [EC: 1.2.1.3] (inferred from 100% identity to ccs:CCNA_03695)MetaCyc: 81% identical to aldehyde dehydrogenase (NAD+) (Paracoccus denitrificans PD1222)
Aldehyde dehydrogenase (NAD(+)). [EC: 1.2.1.3]
Predicted SEED Role
"Aldehyde dehydrogenase B (EC 1.2.1.22)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism (EC 1.2.1.22)
MetaCyc Pathways
- ethanol degradation II (3/3 steps found)
- ethanol degradation IV (3/3 steps found)
- L-lactaldehyde degradation (aerobic) (2/2 steps found)
- superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
- phytol degradation (3/4 steps found)
- ethanol degradation III (2/3 steps found)
- hypotaurine degradation (2/3 steps found)
- methylglyoxal degradation IV (2/3 steps found)
- methylglyoxal degradation V (2/3 steps found)
- mitochondrial NADPH production (yeast) (3/5 steps found)
- superpathway of methylglyoxal degradation (5/8 steps found)
- L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
- fatty acid α-oxidation I (plants) (2/4 steps found)
- putrescine degradation III (2/4 steps found)
- serotonin degradation (4/7 steps found)
- histamine degradation (1/3 steps found)
- 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
- noradrenaline and adrenaline degradation (8/13 steps found)
- dopamine degradation (2/5 steps found)
- lactate biosynthesis (archaea) (2/5 steps found)
- octane oxidation (2/5 steps found)
- aromatic biogenic amine degradation (bacteria) (3/8 steps found)
- ceramide degradation by α-oxidation (2/7 steps found)
- sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
- alkane oxidation (1/6 steps found)
- L-rhamnose degradation II (2/8 steps found)
- limonene degradation IV (anaerobic) (1/7 steps found)
- superpathway of fucose and rhamnose degradation (4/12 steps found)
- ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
KEGG Metabolic Maps
- 1,2-Dichloroethane degradation
- 3-Chloroacrylic acid degradation
- Arginine and proline metabolism
- Ascorbate and aldarate metabolism
- Butanoate metabolism
- Fatty acid metabolism
- Glycerolipid metabolism
- Glycolysis / Gluconeogenesis
- Histidine metabolism
- Limonene and pinene degradation
- Lysine degradation
- Propanoate metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
- Valine, leucine and isoleucine degradation
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.2.1.22, 1.2.1.3
Use Curated BLAST to search for 1.2.1.22 or 1.2.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3CCV8 at UniProt or InterPro
Protein Sequence (506 amino acids)
>CCNA_03695 aldehyde dehydrogenase (Caulobacter crescentus NA1000) MTKPEFIESLSRPPFKARYDNFIGGQWVAPADGRYFDNSSPIHGRKICEIARSQAIDIER ALDAAHAAKAGWARTSAADRSRILLRIADRMEENLAALATAETWDNGKPIRETLAADIPL AIDHFRYFAGCLRSQEGSISEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALA AGNCVVLKPAEQTPASIMVWAEMIGDLLPAGVLNIVNGFGLEAGKPLASSPRIAKIAFTG ETSTGRLIMQYAAQNLIPVTLELGGKSPNIFFDDVAREDDDYLDKALEGFTMFALNQGEV CTCPSRALVQESIYEKFMERALKRVNAVVQGSPLDPATMIGAQASEEQLNKILGYMDIGR NEGAKLLAGGQRKILPGQLADGYYVEPTVFEGHNKMRIFQEEIFGPVLAVTTFKTEEEAL EIANDTAFGLGAGVWSRDANRCYRFGRGIEAGRVWTNCYHAYPAHAAFGGYKQSGVGRET HKMMLDHYQQTKNMLVSYSPKALGFF