Protein Info for CCNA_03689 in Caulobacter crescentus NA1000

Annotation: alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR00518: alanine dehydrogenase" amino acids 1 to 364 (364 residues), 474.9 bits, see alignment E=8e-147 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 160.4 bits, see alignment E=1e-50 PF01262: AlaDh_PNT_C" amino acids 141 to 351 (211 residues), 275.1 bits, see alignment E=1.2e-85 PF01488: Shikimate_DH" amino acids 169 to 268 (100 residues), 26.6 bits, see alignment E=2e-09 PF02826: 2-Hacid_dh_C" amino acids 169 to 268 (100 residues), 30.5 bits, see alignment E=7.8e-11 PF00070: Pyr_redox" amino acids 170 to 209 (40 residues), 22.9 bits, see alignment 3.4e-08 PF03446: NAD_binding_2" amino acids 171 to 268 (98 residues), 21.6 bits, see alignment E=7e-08

Best Hits

Swiss-Prot: 63% identical to DHA_HALED: Alanine dehydrogenase (ald) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 100% identity to ccs:CCNA_03689)

MetaCyc: 52% identical to L-alanine/glycine dehydrogenase monomer (Mycobacterium tuberculosis H37Rv)
Glycine dehydrogenase. [EC: 1.4.1.10]; Alanine dehydrogenase. [EC: 1.4.1.10, 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1 or 1.4.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC84 at UniProt or InterPro

Protein Sequence (370 amino acids)

>CCNA_03689 alanine dehydrogenase (Caulobacter crescentus NA1000)
MRVGVPSEIKPGEHRVGLTPTAVREYVGHGHTVIVQSGAGLGAGYADDVYVKAGASIVAD
ADAVFAGADMIVKVKEPQKVEWEKLEPRHILFTYLHLAPDPAQTEGLLKSGCAAIAYETV
TDAKGGLPLLAPMSEVAGRIAVFSAAETLLKHNGGMGLLLSGVPGVPPARVAVLGGGVVG
SNAARMAAGLGAEVVVLERSIPRMRELDDLYQGRILTRYSTFGAVEEEILKADVVIGAVL
TAGAAAPKLVRREHLKQMKPGSVLVDVSIDQGGCFETSKPTTHAQPTYTVDGVVHYCVAN
MPGAAPRTSSEALGNATLPFGLALADKGLDALKANAHLARGLNVLNGELTHPAVAEALGK
TSIDPYGAWK