Protein Info for CCNA_03589 in Caulobacter crescentus NA1000

Annotation: RNA polymerase EcfG family sigma factor sigT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF22029: PhyR_sigma2" amino acids 25 to 76 (52 residues), 43.1 bits, see alignment E=8.6e-15 PF04542: Sigma70_r2" amino acids 27 to 89 (63 residues), 57.7 bits, see alignment E=2.1e-19 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 27 to 169 (143 residues), 71.8 bits, see alignment E=2.6e-24 PF07638: Sigma70_ECF" amino acids 87 to 169 (83 residues), 27.8 bits, see alignment E=5.8e-10 PF08281: Sigma70_r4_2" amino acids 115 to 167 (53 residues), 56.8 bits, see alignment E=3.6e-19 PF04545: Sigma70_r4" amino acids 121 to 168 (48 residues), 24.4 bits, see alignment E=4.1e-09

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to ccr:CC_3475)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDS0 at UniProt or InterPro

Protein Sequence (201 amino acids)

>CCNA_03589 RNA polymerase EcfG family sigma factor sigT (Caulobacter crescentus NA1000)
MVAEQVGRSPPDPVRDNSFKRELVTLIPHLRAFARTLTGDPTAADDLAQDAMMKAWDARA
SFQLGTNMKAWTFMILRNQFYSEKRRSWRQSQLDQEAAERTLVAVDDPEAPVALDELRQG
LSMLPAEQREALILVGAGGFAYEEAAEICNCAVGTVKSRVSRARRALQAILESGAYDRDG
AAAGDAMRAILADAERLSALR