Protein Info for CCNA_03581 in Caulobacter crescentus NA1000

Annotation: transporter, drug/metabolite exporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details PF00892: EamA" amino acids 146 to 275 (130 residues), 61.5 bits, see alignment E=5e-21

Best Hits

Swiss-Prot: 47% identical to RHTA_ECOLI: Threonine/homoserine exporter RhtA (rhtA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3468)

MetaCyc: 47% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBY7 at UniProt or InterPro

Protein Sequence (290 amino acids)

>CCNA_03581 transporter, drug/metabolite exporter family (Caulobacter crescentus NA1000)
MPGARASFLPYAALLAAIVTLCVGTSFAKTLFPLVGAQGVSAYRVGFSALILLAIWRPWR
HRLSAADLRAVAMYGAVMGTMNLCFYMSIRTIPLGVAIAIEFMGPLVLAVAHSRRLIHFV
WIALAVLGLGLLLPINPGAEPLDPVGVAYACAAAVMWALYIILGKRAAHLHAGRSVALGM
TTAALIVAPIGIVSAGPVLFDPKIAALGLVVAVLSSAIPYSLEMIALRGIPKRSFGVLLS
LEPAVGALAGLAILNERLSLTQWLAIAAIVAASAGTILSTPAEAVSEDVP