Protein Info for CCNA_03543 in Caulobacter crescentus NA1000

Annotation: gamma-glutamyl phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PROA_CAUVC: Gamma-glutamyl phosphate reductase (proA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 100% identity to ccs:CCNA_03543)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
L-ornithine biosynthesis II (2/3 steps found)
L-citrulline biosynthesis (5/8 steps found)
superpathway of L-citrulline metabolism (7/12 steps found)
L-N^δ-acetylornithine biosynthesis (3/7 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CF85 at UniProt or InterPro

Protein Sequence (424 amino acids)

>CCNA_03543 gamma-glutamyl phosphate reductase (Caulobacter crescentus NA1000)
MDDAGASLQAIMAGMGRTAREGARALRLATPEQRTAAIQAMAVAIREDADAILTANAKDL
ARAEANGVSGPMLDRLALDAARLEGVAAGVEAVAAVPDPVGVATSRWTRPNGLDIARVRT
PIGVIAMIYESRPNVTADAAALCVRSGNAVILRGGSECIHSNLAIHAAIARGLQKAGLPT
AAVQAVKTPDRAAVGMILAGLDRTIDLIIPRGGKSLVARVQAEARAPVLGHLEGLNHVFV
HAAADLKKAVEVVVNAKLRRVSVCGSAETLLIDQAAADKLLPPIADALIKAGCELRGDAA
ARAIEPTMKKATVEDWTTEYLAPILSVAVVDGVAGAARHIASYGSGHTDAIITEDAAAAE
AFIAEVDSAIVLVNASTQFADGGEFGFGAEIGIATDKLHARGPVGAEQLTTFKYVVRGTG
QTRP