Protein Info for CCNA_03532 in Caulobacter crescentus NA1000

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 217 to 245 (29 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details PF13687: DUF4153" amino acids 59 to 419 (361 residues), 48.2 bits, see alignment E=4.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03532)

Predicted SEED Role

"FIG00484024: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDJ6 at UniProt or InterPro

Protein Sequence (582 amino acids)

>CCNA_03532 hypothetical protein (Caulobacter crescentus NA1000)
MDATRSRDAAILRLAIGLAQGIALFLLQKADESKTWPATQPMLYAPLLVCVLMVPLLPLA
ALSAMRRANLVVWTAVATAVTAILAVHAAWVGAAPDRIGASPLSPPLFLATAAMLFIAHH
LVQPADAAGKPVAPYPAYFDLTWTNGVRLALSLAFTGAFWLLLFLAAALFKLIGIEAIGK
LIGETAFAFPATGLMFAAAVHMAVQLTEARAGLVRGALTVGLTLLGWLLPLMVLIGGGFL
ATLPFTGLAPLWGTKAATALLLSAAAALILLINAAYQDGEEPPHLIPCLAARIAGLLLIP
IVILAGYALWLRIDQYGLTPERVVAGVYLVVAIGFTAGYALAAVKPGPWMKPLERTNPIM
AAACVLLLIALFTPIANPARLSVASQVKRLESGEVAADKFDFQFLRFDAGRYGREALDRL
KTHPNAEIAKRARDAAASTEKQYPAGEIRPDFKAMAVYPAGKALPQSFVAQDWSQPSGSN
CTAIAMQCPALVADVDADGKDEVLLAEGDRLKVFSEGADRVWTLTAVAAAGCESYDLEAW
MKTGAPSLSEPVARRDLILGGRRLALQPASKDCQVSVTPPPR