Protein Info for CCNA_03527 in Caulobacter crescentus NA1000

Annotation: glutamate-cysteine ligase family 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR01436: glutamate--cysteine ligase" amino acids 14 to 453 (440 residues), 658.5 bits, see alignment E=1.9e-202 PF04107: GCS2" amino acids 50 to 357 (308 residues), 365.2 bits, see alignment E=1.3e-113

Best Hits

Swiss-Prot: 59% identical to GSH1_TOBAC: Glutamate--cysteine ligase, chloroplastic (GSH1) from Nicotiana tabacum

KEGG orthology group: K01919, glutamate--cysteine ligase [EC: 6.3.2.2] (inferred from 100% identity to ccr:CC_3414)

MetaCyc: 57% identical to gamma-glutamylcysteine synthetase (Lotus japonicus)
Glutamate--cysteine ligase. [EC: 6.3.2.2]

Predicted SEED Role

"Glutamate--cysteine ligase (EC 6.3.2.2)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle (EC 6.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDJ0 at UniProt or InterPro

Protein Sequence (453 amino acids)

>CCNA_03527 glutamate-cysteine ligase family 2 (Caulobacter crescentus NA1000)
MADTASVQERQLTLDDLTAYFAKGSKPKEAFRVGAEHEKFGFYLGSHEPVPYEGDKGVHA
LLTGLQRFGWTPVMEGPTIIGLERNGANVSLEPGGQFELSGAPLSTMHEICEETGQHLDE
VKTVADELGLGFTGLGFSPKWTRGQVPIMPKGRYVIMRNYMPKVGNLGLDMMLRTCTVQA
NLDFSSEADMVAKFRMSLALQPIATALFANSPFTEGKPNGFLSARANVWTDTDPNRTGLL
DFVFEDGFDFERYARYALDVPMYFVKRGDKYIDVAGRSFRDFIEGKLPELPGEIATMKDF
ADHTTTAFPEVRLKTYLEMRGADAGPWSRLCALPALWTGVFYDDAALAAAWDLCKDWTLE
DREGLRRDVPKLGLKAQVAGRSAQDVAKDFVAVAKAGLKNRAQLNGGFLDETIYLGELEQ
IADSGITPAEKLLSLYNGAWGGDIERVFTDCAY