Protein Info for CCNA_03514 in Caulobacter crescentus NA1000

Annotation: cytochrome c oxidase assembly protein ctaG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details PF04442: CtaG_Cox11" amino acids 42 to 185 (144 residues), 181 bits, see alignment E=7.7e-58

Best Hits

Swiss-Prot: 55% identical to COXZ_RHILO: Cytochrome c oxidase assembly protein CtaG (ctaG) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02258, cytochrome c oxidase subunit XI assembly protein (inferred from 100% identity to ccs:CCNA_03514)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBS6 at UniProt or InterPro

Protein Sequence (216 amino acids)

>CCNA_03514 cytochrome c oxidase assembly protein ctaG (Caulobacter crescentus NA1000)
MSQNPTSNDDLTPQQQMARRNKKVAVICVATFCGMIGAAYASVPLYKLFCQVTGFDGTVR
RAEVAPTRVLDRKITVRFDANIRELPWRFQALQPKQDIRIGDTGLTFFKVTNPTDKPITG
RALYNVVPEQAGPYFQKLECFCFTSQTIQPGQTVEFPVVYFVDPQYADDPETKGKPEITL
SYTFFPAVDDDKPGQVAAATTPRIVDPLGGAPSRGL