Protein Info for CCNA_03414 in Caulobacter crescentus NA1000

Annotation: Rubrum transdehydrogenase NAD-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 168 to 181 (14 residues), see Phobius details PF05222: AlaDh_PNT_N" amino acids 8 to 142 (135 residues), 155 bits, see alignment E=1.4e-49 PF01262: AlaDh_PNT_C" amino acids 146 to 374 (229 residues), 230.8 bits, see alignment E=1.3e-72

Best Hits

Swiss-Prot: 56% identical to PNTAA_RHORU: NAD(P) transhydrogenase subunit alpha part 1 (pntAA) from Rhodospirillum rubrum

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 100% identity to ccs:CCNA_03414)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC88 at UniProt or InterPro

Protein Sequence (380 amino acids)

>CCNA_03414 Rubrum transdehydrogenase NAD-binding (Caulobacter crescentus NA1000)
MPMAVIAVTKETRADETRVAATPETVKKLGAAGFSVVIQAGAGTAASYPDADYEAAGAKI
AKTAKDALKDADVLFKVRAPESAEIAALKKGAIVAAALNPYQDKETLDALAKAGATAIAM
EFIPRITRAQVMDMLSSQANLAGYRAVIEGAEAYGKALPMMMTAAGTVAAAKVFIMGVGV
AGLQAIATARRLGAVVTATDVRPATKEQVESLGAKFLAVEDEEFKNAQTAGGYAKEMSKE
YQAKQAELVSSHIAKQDIVITTALIPGRPAPKLVSAAQVASMKPGSILVDLAIEQGGNVE
GAKLNETVVTEGGVKILGHANLPGRIAADASALYARNLFALSSLFTNKEGAFAPNFEDEI
LQAAVVIRDGAIVHPNLKTA