Protein Info for CCNA_03392 in Caulobacter crescentus NA1000

Annotation: phosphoribosylaminoimidazole carboxylase NCAIR mutase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF22660: RS_preATP-grasp-like" amino acids 11 to 107 (97 residues), 108.5 bits, see alignment E=2.8e-35 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 11 to 356 (346 residues), 398.8 bits, see alignment E=1.3e-123 PF02222: ATP-grasp" amino acids 115 to 291 (177 residues), 190.5 bits, see alignment E=3.2e-60 PF17769: PurK_C" amino acids 314 to 356 (43 residues), 56.6 bits, see alignment 2.6e-19

Best Hits

Swiss-Prot: 52% identical to PURK_BRUME: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 100% identity to ccr:CC_3283)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBG8 at UniProt or InterPro

Protein Sequence (361 amino acids)

>CCNA_03392 phosphoribosylaminoimidazole carboxylase NCAIR mutase subunit (Caulobacter crescentus NA1000)
MASFPLVPGSTIGVLGGGQLGRMLALAAARLGFDVVIQDPEEGSPAGRVAARQIVAAYDD
RWALKRLAEACDVVTYEFENVPADTVSELTALGAMVSPGAKALAAAQDRVAEKTFMAEIG
VPTVAFAAVHDSQSLADAVARIGAPSLLKTRREGYDGKGQAWIQKVSDAEAAFDKIGRQP
AILEAPADFGRELSVIAARGRDGEIACYPVSENHHEGGVLRRTVAPAKITPATRDQAESI
VAKILTALDYVGVIGVELFELSGGKLLVNEFAPRVHNTGHWTQDGCEVDQFEQHIRAVAG
WPLGPTAPHHHVEMTNLLGADVDAWKKLAAEPETRVHLYGKGEARPGRKMGHVNRLRSLR
D