Protein Info for CCNA_03362 in Caulobacter crescentus NA1000

Annotation: ECF-family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF04542: Sigma70_r2" amino acids 33 to 93 (61 residues), 52.6 bits, see alignment E=6.4e-18 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 38 to 174 (137 residues), 65.9 bits, see alignment E=1.7e-22 PF07638: Sigma70_ECF" amino acids 52 to 167 (116 residues), 30.4 bits, see alignment E=7.2e-11 PF08281: Sigma70_r4_2" amino acids 118 to 170 (53 residues), 39.6 bits, see alignment E=6.7e-14 PF04545: Sigma70_r4" amino acids 123 to 170 (48 residues), 40.7 bits, see alignment E=2.6e-14

Best Hits

Swiss-Prot: 100% identical to SIGF_CAUVN: ECF RNA polymerase sigma factor SigF (sigF) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to ccr:CC_3253)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCX2 at UniProt or InterPro

Protein Sequence (179 amino acids)

>CCNA_03362 ECF-family RNA polymerase sigma factor (Caulobacter crescentus NA1000)
MTDTETRLKALMLRGLDGDTAAYREGLALLGVRLRAYFMRRMSGAPGDVEDLVQETLLAV
HLKRSTWDSAQSFTAWAHAVARYKLIDHWRRRKIRQTLPLEDHVDFLADDAPDPGVALEL
DRALASLPQRQRMLVSDVKLTGLSLAEAGARAGISEGAAKVALHRALKALAERMRRADG