Protein Info for CCNA_03335 in Caulobacter crescentus NA1000

Annotation: PP-loop family cell cycle control ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 22 to 202 (181 residues), 106.2 bits, see alignment E=1e-34 PF01171: ATP_bind_3" amino acids 23 to 202 (180 residues), 102.2 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 100% identical to TILS_CAUVC: tRNA(Ile)-lysidine synthase (tilS) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to ccs:CCNA_03335)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CEM1 at UniProt or InterPro

Protein Sequence (408 amino acids)

>CCNA_03335 PP-loop family cell cycle control ATPase (Caulobacter crescentus NA1000)
MRLDQVRAALDRRLDPASRAPLAVGFSGGGDSLFLLKTVLDWARPLDRPVLALVVDHQLQ
PQSTAWTAEAVAKARALGAAALGLTWTDQKPRTGLPAAARRARHALLATAAREAGARVLI
LGHTASDLAEGVAMRAEGSSVSNPRAWAPSPVWPEGRGLFVLRPLLTLTRAEIRDALTRE
GETWLDDPANLDLRYARARARAAGALTPLLPVRESPPPGVFEIDPAGAIRLPRDVVPAHL
AAALLCASGAERPPRGDRLARLVERLRSGARFTATLAGARIEADQAVLICRDAGEAARGG
LARLDLAPGACGVWDGRWEVVAGKTALAVVALRGRTSSLPAEQRARLSAIAPAVRPSLPV
LLSLDGDAPGELVLDDLQLEADGEARVRSLVPDRFKAAVGLLDQESVT