Protein Info for CCNA_03331 in Caulobacter crescentus NA1000

Annotation: phosphomethylpyrimidine kinase/hydroxymethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase" amino acids 9 to 261 (253 residues), 300 bits, see alignment E=6e-94 PF08543: Phos_pyr_kin" amino acids 16 to 260 (245 residues), 310 bits, see alignment E=1.1e-96 PF00294: PfkB" amino acids 94 to 238 (145 residues), 34.3 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 53% identical to THID_STRCO: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 100% identity to ccs:CCNA_03331)

MetaCyc: 47% identical to bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (Escherichia coli K-12 substr. MG1655)
Phosphomethylpyrimidine kinase. [EC: 2.7.4.7]; Hydroxymethylpyrimidine kinase. [EC: 2.7.4.7, 2.7.1.49]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC24 at UniProt or InterPro

Protein Sequence (267 amino acids)

>CCNA_03331 phosphomethylpyrimidine kinase/hydroxymethylpyrimidine kinase (Caulobacter crescentus NA1000)
MSQAHKGRVLVIAGSDSGGGAGIQADIKTITALGGYAATAITAVTVQNTLGVTGVHPIPL
DVIAAQARAVLDDIGADAIKTGMLGDAAVVEIVAQALDHAGGVPAVVDPVMVAKGGAPLL
AEAAIGAVKSLMIPRAFLLTPNAPEAAALTGLVVETTEDLRRAGEALLALGARAVLMKGG
HVAGERVVDVLMTPAGETTFEGERIDTRHTHGTGCTLASACAAGLAKGLKLEEAVAQAWN
YVHEAMLRAPGFGAGHGPLDHGWTLRT